PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02145g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 344aa    MW: 38520.3 Da    PI: 5.1053
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02145g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092723062155
                               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                               k +yps++++  LA+++gL+++q+ +WF N+R ++
  Niben101Scf02145g02001.1 272 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 306
                               569*****************************885 PP

2ELK41.23.4e-14226247122
                       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                               ELK qLlrKYsgyLgsLkqEF+
  Niben101Scf02145g02001.1 226 ELKGQLLRKYSGYLGSLKQEFM 247
                               9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-2089133IPR005540KNOX1
PfamPF037905.2E-2391130IPR005540KNOX1
SMARTSM012565.8E-26138189IPR005541KNOX2
PfamPF037912.5E-21142188IPR005541KNOX2
PfamPF037895.6E-11226247IPR005539ELK domain
PROSITE profilePS5121311.174226246IPR005539ELK domain
SMARTSM011882.8E-8226247IPR005539ELK domain
PROSITE profilePS5007112.957246309IPR001356Homeobox domain
SuperFamilySSF466891.45E-19248323IPR009057Homeodomain-like
SMARTSM003891.2E-12248313IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-28251311IPR009057Homeodomain-like
CDDcd000861.97E-12258310No hitNo description
PfamPF059208.1E-17266305IPR008422Homeobox KN domain
PROSITE patternPS000270284307IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEGGGSSGNT SCLMGYGDDN NNNNNNSGNA ALCPPPMMMM MMPPQPVTNN NAESSNNIGG  60
NNNDNILFLP FMDNNNNNPH EDANCSSSTS IKSKIMAHPH YPRLLSAYVN CQKIGAPPEV  120
VARLEEVCAT SATIGRNSGG IIGEDPALDQ FMEAYCEMLT KYEQELSKPF KEAMVFLSRI  180
ECQFKALTLT SSSESALGEA VDRNGSSEEE VDVNNGFIDP QAEDQELKGQ LLRKYSGYLG  240
SLKQEFMKKR KKGKLPKEAR QQLLDWWTRH YKWPYPSESQ KLALAESTGL DQKQINNWFI  300
NQRKRHWKPS EDMQFVVMDA AHPHYYMDNV LGNPFPMDIT PTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241250LKQEFMKKRK
2247251KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613678.10.0PREDICTED: homeobox protein knotted-1-like LET6 isoform X2
RefseqXP_016509033.10.0PREDICTED: homeobox protein knotted-1-like LET6 isoform X2
SwissprotO222991e-160LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLQ8GUS60.0Q8GUS6_TOBAC; Knotted-1-like homeobox protein H1
STRINGPGSC0003DMT4000430831e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-136KNOX/ELK homeobox transcription factor